PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00003435-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family ZF-HD
Protein Properties Length: 246aa    MW: 27127.5 Da    PI: 8.8282
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00003435-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.11.6e-3145100359
            ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                            +v Y+eClkNhAa++Gg+++DGCgEfmps g+eg+ +alkCaAC CHRnFHRre++ 
  SMil_00003435-RA_Salv  45 RVSYRECLKNHAANIGGNVTDGCGEFMPS-GDEGSLEALKCAACSCHRNFHRREHHG 100
                            799*************************9.999********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-2146106IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047709.7E-294698IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.3824897IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015663.4E-294897IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466895.38E-18165235IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.3E-30174237IPR009057Homeodomain-like
TIGRFAMsTIGR015653.0E-30178234IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MSLPGEDKEM RVQGYSLENP PDKSRGSDPY SGGSKHKPGS NNHPRVSYRE CLKNHAANIG  60
GNVTDGCGEF MPSGDEGSLE ALKCAACSCH RNFHRREHHG ESPATAAMVH PLQLPPPLPS  120
PSMSQHRAGT HWSPMVQPVK MAFGGAGSAG TDSSSEELNF NAFHSSAVAP PPPQFVAKKR  180
FRTKFTAEQK EKMLEFAEKL GWRIPREDDT EVQRFCAEVG VKRQVFKVWM HNNKTSSSSK  240
KIPQEF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A4e-271792361875ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083674.11e-135PREDICTED: zinc-finger homeodomain protein 5
SwissprotQ9M9S06e-63ZHD4_ARATH; Zinc-finger homeodomain protein 4
TrEMBLA0A022RZP32e-98A0A022RZP3_ERYGU; Uncharacterized protein
STRINGPGSC0003DMT4000095815e-88(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.21e-59homeobox protein 31